RPS3A anticorps (N-Term)

N° du produit ABIN631017

Détail du produit anti-RPS3A anticorps

Antigène: RPS3A (Ribosomal Protein S3A (RPS3A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS3A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS3 A antibody was raised against the N terminal of RPS3

Purification: Affinity purified

Immunogène: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS3A Blocking Peptide, catalog no. 33R-1414, is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS3A

Antigène: RPS3A (Ribosomal Protein S3A (RPS3A))

Autre désignation: RPS3A (RPS3A Produits)

Sujet: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 30 kDa (MW of target protein)