WARS anticorps (N-Term)

N° du produit ABIN631021

Cet anticorps Lapin Polyclonal détecte spécifiquement WARS dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour WARS anticorps (N-Term) (ABIN631021)

Antigène: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WARS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WARS anticorps

Épitope: N-Term

Specificité: WARS antibody was raised against the N terminal of WARS

Purification: Affinity purified

Immunogène: WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WARS Blocking Peptide, (ABIN937851), is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WARS

Antigène: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Autre désignation: WARS

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

Poids moléculaire: 52 kDa (MW of target protein)