MTX2 anticorps (N-Term)

N° du produit ABIN631023

Détail du produit anti-MTX2 anticorps

Antigène: MTX2 (Metaxin 2 (MTX2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTX2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Metaxin 2 antibody was raised against the N terminal of MTX2

Purification: Affinity purified

Immunogène: Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTX2

Antigène: MTX2 (Metaxin 2 (MTX2))

Autre désignation: Metaxin 2 (MTX2 Produits)

Synonymes: anticorps wu:fc02d09, anticorps xmtx2, anticorps 1500012G02Rik, anticorps metaxin 2, anticorps metaxin 2 L homeolog, anticorps mtx2, anticorps mtx2.L, anticorps MTX2, anticorps Mtx2

Sujet: MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.

Poids moléculaire: 29 kDa (MW of target protein)