DLD anticorps (Middle Region)

N° du produit ABIN631024

Cet anticorps Lapin Polyclonal détecte spécifiquement DLD dans WB. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour DLD anticorps (Middle Region) (ABIN631024)

Antigène: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLD anticorps

Épitope: Middle Region

Specificité: DLD antibody was raised against the middle region of DLD

Purification: Affinity purified

Immunogène: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLD

Antigène: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Autre désignation: DLD

Sujet: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis