DLD anticorps (Middle Region)

N° du produit ABIN631024

Détail du produit anti-DLD anticorps

Antigène: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLD est non-conjugé

Application: Western Blotting (WB)

Specificité: DLD antibody was raised against the middle region of DLD

Purification: Affinity purified

Immunogène: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLD

Antigène: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Autre désignation: DLD (DLD Produits)

Synonymes: anticorps DLDD, anticorps DLDH, anticorps E3, anticorps GCSL, anticorps LAD, anticorps PHE3, anticorps AI315664, anticorps AI746344, anticorps wu:fb24b05, anticorps DLD, anticorps DDBDRAFT_0183800, anticorps DDBDRAFT_0216232, anticorps DDB_0183800, anticorps DDB_0216232, anticorps sc:d0402, anticorps dihydrolipoamide dehydrogenase, anticorps dihydrolipoyl dehydrogenase, anticorps deltaD, anticorps DLD, anticorps Dld, anticorps dldh, anticorps AT4G16155, anticorps CND05840, anticorps bfmBC, anticorps GCSL, anticorps LACBIDRAFT_182385, anticorps UREG_06178, anticorps lpd, anticorps TAGG_RS02070, anticorps Arnit_2606, anticorps Mesil_1945, anticorps Trad_2118, anticorps Acear_0640, anticorps Fbal_0372, anticorps Ilyop_1890, anticorps Ftrac_1733, anticorps Ocepr_1753, anticorps Intca_2017, anticorps Deima_0504, anticorps dld

Sujet: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis