ETFB anticorps (C-Term)

N° du produit ABIN631031

Détail du produit anti-ETFB anticorps

Antigène: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ETFB est non-conjugé

Application: Western Blotting (WB)

Specificité: ETFB antibody was raised against the C terminal of ETFB

Purification: Affinity purified

Immunogène: ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ETFB

Antigène: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Autre désignation: ETFB (ETFB Produits)

Synonymes: anticorps MWF20.14, anticorps MWF20_14, anticorps electron transfer flavoprotein beta, anticorps 0610009I16Rik, anticorps 2810441H06Rik, anticorps MADD, anticorps electron transfer flavoprotein beta, anticorps electron transfer flavoprotein subunit beta, anticorps electron transferring flavoprotein, beta polypeptide, anticorps electron transfer flavoprotein beta subunit L homeolog, anticorps electron transfer flavoprotein beta subunit, anticorps ETFBETA, anticorps FixA, anticorps Etfb, anticorps etfb.L, anticorps ETFB

Sujet: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Poids moléculaire: 28 kDa (MW of target protein)