Monoamine Oxidase A anticorps (N-Term)

N° du produit ABIN631037

L’anticorps Lapin Polyclonal anti-Monoamine Oxidase A a été validé pour WB. Il convient pour détecter Monoamine Oxidase A dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour Monoamine Oxidase A anticorps (N-Term) (ABIN631037)

Antigène: Monoamine Oxidase A (MAOA)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Monoamine Oxidase A anticorps

Épitope: N-Term

Specificité: MAOA antibody was raised against the N terminal of MAOA

Purification: Affinity purified

Immunogène: MAOA antibody was raised using the N terminal of MAOA corresponding to a region with amino acids GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAOA Blocking Peptide, (ABIN938871), is also available for use as a blocking control in assays to test for specificity of this MAOA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Monoamine Oxidase A

Antigène: Monoamine Oxidase A (MAOA)

Autre désignation: MAOA

Sujet: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.

Poids moléculaire: 60 kDa (MW of target protein)