ACAT1 anticorps (Middle Region)

N° du produit ABIN631041

Détail du produit anti-ACAT1 anticorps

Antigène: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACAT1 antibody was raised against the middle region of ACAT1

Purification: Affinity purified

Immunogène: ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAT1 Blocking Peptide, catalog no. 33R-3310, is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAT1

Antigène: ACAT1 (Acetyl-CoA Acetyltransferase 1 (ACAT1))

Autre désignation: ACAT1 (ACAT1 Produits)

Synonymes: anticorps ACAT, anticorps MAT, anticorps T2, anticorps THIL, anticorps RATACAL, anticorps 6330585C21Rik, anticorps Acat, anticorps fd16h07, anticorps fd20g06, anticorps wu:fd16h07, anticorps wu:fd20g06, anticorps zgc:86832, anticorps acat1-a, anticorps acetyl-CoA acetyltransferase 1, anticorps acetyl-Coenzyme A acetyltransferase 1, anticorps acetyl-CoA acetyltransferase 1 L homeolog, anticorps ACAT1, anticorps Acat1, anticorps acat1, anticorps acat1.L

Sujet: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Poids moléculaire: 41 kDa (MW of target protein)