INPP5B anticorps (Middle Region)

N° du produit ABIN631045

Détail du produit anti-INPP5B anticorps

Antigène: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INPP5B est non-conjugé

Application: Western Blotting (WB)

Specificité: INPP5 B antibody was raised against the middle region of INPP5

Purification: Affinity purified

Immunogène: INPP5 B antibody was raised using the middle region of INPP5 corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INPP5B Blocking Peptide, catalog no. 33R-3984, is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INPP5B

Antigène: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Autre désignation: INPP5B (INPP5B Produits)

Synonymes: anticorps 75kDa, anticorps AW260155, anticorps INPP5P, anticorps 5PTase, anticorps inositol polyphosphate-5-phosphatase B, anticorps type II inositol 1,4,5-trisphosphate 5-phosphatase-like, anticorps inositol polyphosphate-5-phosphatase B L homeolog, anticorps inositol polyphosphate 5-phosphatase OCRL-1, anticorps INPP5B, anticorps LOC100224437, anticorps inpp5b.L, anticorps LOC100159919, anticorps Inpp5b

Sujet: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Poids moléculaire: 77 kDa (MW of target protein)