FTCD anticorps (Middle Region)
-
- Antigène Voir toutes FTCD Anticorps
- FTCD (Formiminotransferase Cyclodeaminase (FTCD))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FTCD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FTCD antibody was raised against the middle region of FTCD
- Purification
- Affinity purified
- Immunogène
- FTCD antibody was raised using the middle region of FTCD corresponding to a region with amino acids KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEK
- Top Product
- Discover our top product FTCD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FTCD Blocking Peptide, catalog no. 33R-4373, is also available for use as a blocking control in assays to test for specificity of this FTCD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTCD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FTCD (Formiminotransferase Cyclodeaminase (FTCD))
- Autre désignation
- FTCD (FTCD Produits)
- Synonymes
- anticorps LCHC1, anticorps FTCD, anticorps wu:fp37b11, anticorps zgc:63647, anticorps formimidoyltransferase cyclodeaminase, anticorps formiminotransferase cyclodeaminase, anticorps formiminotransferase-cyclodeaminase, anticorps formimidoyltransferase cyclodeaminase L homeolog, anticorps FTCD, anticorps Ftcd, anticorps ftcd, anticorps DP2350, anticorps Cbei_0990, anticorps TRQ2_1223, anticorps GAU_0899, anticorps ftcd.L
- Sujet
- FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.
- Poids moléculaire
- 59 kDa (MW of target protein)
-