TMLHE anticorps (Middle Region)

N° du produit ABIN631052

Détail du produit anti-TMLHE anticorps

Antigène: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMLHE est non-conjugé

Application: Western Blotting (WB)

Specificité: TMLHE antibody was raised against the middle region of TMLHE

Purification: Affinity purified

Immunogène: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMLHE Blocking Peptide, catalog no. 33R-7434, is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMLHE

Antigène: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Autre désignation: TMLHE (TMLHE Produits)

Synonymes: anticorps AUTSX6, anticorps BBOX2, anticorps TMLD, anticorps TMLH, anticorps TMLHED, anticorps XAP130, anticorps Bbox2, anticorps D430017M14Rik, anticorps Tmlh, anticorps trimethyllysine dioxygenase, mitochondrial, anticorps trimethyllysine hydroxylase, epsilon, anticorps trimethyllysine hydroxylase, epsilon L homeolog, anticorps LOC465953, anticorps TMLHE, anticorps tmlhe, anticorps tmlhe.L, anticorps Tmlhe

Sujet: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Poids moléculaire: 49 kDa (MW of target protein)