TMLHE anticorps (Middle Region)

N° du produit ABIN631052

L’anticorps anti-TMLHE Polyclonal Lapin est utilisé pour la détection de TMLHE dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour TMLHE anticorps (Middle Region) (ABIN631052)

Antigène: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMLHE est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMLHE anticorps

Épitope: Middle Region

Specificité: TMLHE antibody was raised against the middle region of TMLHE

Purification: Affinity purified

Immunogène: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMLHE Blocking Peptide, (ABIN5616693), is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMLHE

Antigène: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Autre désignation: TMLHE

Sujet: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Poids moléculaire: 49 kDa (MW of target protein)