ACADS anticorps (N-Term)

N° du produit ABIN631058

L’anticorps Lapin Polyclonal anti-ACADS a été validé pour WB. Il convient pour détecter ACADS dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ACADS anticorps (N-Term) (ABIN631058)

Antigène: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACADS anticorps

Épitope: N-Term

Specificité: ACADS antibody was raised against the N terminal of ACADS

Purification: Affinity purified

Immunogène: ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADS Blocking Peptide, (ABIN936921), is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACADS

Antigène: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Autre désignation: ACADS

Sujet: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process