HADH anticorps (C-Term)
-
- Antigène Voir toutes HADH Anticorps
- HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HADH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HADH antibody was raised against the C terminal of HADH
- Purification
- Affinity purified
- Immunogène
- HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
- Top Product
- Discover our top product HADH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HADH Blocking Peptide, catalog no. 33R-10203, is also available for use as a blocking control in assays to test for specificity of this HADH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))
- Autre désignation
- HADH (HADH Produits)
- Synonymes
- anticorps HAD, anticorps HADHSC, anticorps hadhsc, anticorps wu:fb66a11, anticorps zgc:86777, anticorps Hadhsc, anticorps HADH1, anticorps HCDH, anticorps HHF4, anticorps MSCHAD, anticorps SCHAD, anticorps AA409008, anticorps AU019341, anticorps AW742602, anticorps Schad, anticorps hydroxyacyl-CoA dehydrogenase, anticorps hydroxyacyl-CoA dehydrogenase L homeolog, anticorps hydroxyacyl-Coenzyme A dehydrogenase, anticorps 3-hydroxyacyl-CoA dehydrogenase (short-chain), anticorps Short chain 3-hydroxyacyl-CoA dehydrogenase, anticorps short chain 3-hydroxyacyl-coa dehydrogenase, anticorps putative short chain 3-hydroxyacyl-CoA dehydrogenase, anticorps HADH, anticorps hadh, anticorps hadh.L, anticorps Hadh, anticorps CNI02410, anticorps Tc00.1047053509717.90, anticorps Tc00.1047053510105.240, anticorps LMJF_36_1140
- Sujet
- HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Monocarboxylic Acid Catabolic Process
-