MPST anticorps (Middle Region)

N° du produit ABIN631061

L’anticorps Lapin Polyclonal anti-MPST a été validé pour WB. Il convient pour détecter MPST dans des échantillons de Humain.

Aperçu rapide pour MPST anticorps (Middle Region) (ABIN631061)

Antigène: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPST est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MPST anticorps

Épitope: Middle Region

Specificité: MPST antibody was raised against the middle region of MPST

Purification: Affinity purified

Immunogène: MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPST Blocking Peptide, (ABIN937480), is also available for use as a blocking control in assays to test for specificity of this MPST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPST

Antigène: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Autre désignation: MPST

Sujet: MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.

Poids moléculaire: 33 kDa (MW of target protein)