MPST anticorps (Middle Region)

N° du produit ABIN631061

Détail du produit anti-MPST anticorps

Antigène: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPST est non-conjugé

Application: Western Blotting (WB)

Specificité: MPST antibody was raised against the middle region of MPST

Purification: Affinity purified

Immunogène: MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPST

Antigène: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Autre désignation: MPST (MPST Produits)

Synonymes: anticorps MST, anticorps TST2, anticorps Mst, anticorps mst, anticorps tst, anticorps tst2, anticorps fa96h11, anticorps mpst, anticorps wu:fa96h11, anticorps mercaptopyruvate sulfurtransferase, anticorps zgc:162544, anticorps mercaptopyruvate sulfurtransferase L homeolog, anticorps mercaptopyruvate sulfurtransferase S homeolog, anticorps MPST, anticorps Mpst, anticorps mpst, anticorps zgc:162544, anticorps sseA, anticorps mpst.L, anticorps mpst.S

Sujet: MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.

Poids moléculaire: 33 kDa (MW of target protein)