MPST anticorps (Middle Region)
-
- Antigène Voir toutes MPST Anticorps
- MPST (Mercaptopyruvate Sulfurtransferase (MPST))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPST est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MPST antibody was raised against the middle region of MPST
- Purification
- Affinity purified
- Immunogène
- MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
- Top Product
- Discover our top product MPST Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPST (Mercaptopyruvate Sulfurtransferase (MPST))
- Autre désignation
- MPST (MPST Produits)
- Synonymes
- anticorps MST, anticorps TST2, anticorps Mst, anticorps mst, anticorps tst, anticorps tst2, anticorps fa96h11, anticorps mpst, anticorps wu:fa96h11, anticorps mercaptopyruvate sulfurtransferase, anticorps zgc:162544, anticorps mercaptopyruvate sulfurtransferase L homeolog, anticorps mercaptopyruvate sulfurtransferase S homeolog, anticorps MPST, anticorps Mpst, anticorps mpst, anticorps zgc:162544, anticorps sseA, anticorps mpst.L, anticorps mpst.S
- Sujet
- MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.
- Poids moléculaire
- 33 kDa (MW of target protein)
-