VPS28 anticorps

N° du produit ABIN631062

Cet anticorps anti-VPS28 Polyclonal Lapin (ABIN631062) détecte spécifiquement VPS28 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour VPS28 anticorps (ABIN631062)

Antigène: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS28 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VPS28 anticorps

Purification: Affinity purified

Immunogène: VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS28 Blocking Peptide, (ABIN5616976), is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS28

Antigène: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Autre désignation: VPS28

Sujet: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Poids moléculaire: 25 kDa (MW of target protein)