-
- Antigène Tous les produits Catenin
- Catenin
- Reactivité
- Humain
- Hôte
- Lapin
- Clonalité
- Polyclonal
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Catenin Blocking Peptide, catalog no. 33R-7753, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Catenin
- Abstract
- Catenin Produits
- Synonymes
- anticorps Bfc, anticorps Catnb, anticorps Mesc, anticorps CTNNB, anticorps MRD19, anticorps armadillo, anticorps catenin (cadherin associated protein), beta 1, anticorps catenin beta 1, anticorps Ctnnb1, anticorps CTNNB1
- Sujet
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.
- Poids moléculaire
- 108 kDa (MW of target protein)
-
Vous êtes ici:
