ACAA2 anticorps (N-Term)

N° du produit ABIN631066

Cet anticorps Lapin Polyclonal détecte spécifiquement ACAA2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour ACAA2 anticorps (N-Term) (ABIN631066)

Antigène: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACAA2 anticorps

Épitope: N-Term

Specificité: ACAA2 antibody was raised against the N terminal of ACAA2

Purification: Affinity purified

Immunogène: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAA2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAA2

Antigène: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Autre désignation: ACAA2

Sujet: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process