MTRF1L anticorps (N-Term)

N° du produit ABIN631071

Détail du produit anti-MTRF1L anticorps

Antigène: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTRF1L est non-conjugé

Application: Western Blotting (WB)

Specificité: MTRF1 L antibody was raised against the N terminal of MTRF1

Purification: Affinity purified

Immunogène: MTRF1 L antibody was raised using the N terminal of MTRF1 corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTRF1L Blocking Peptide, catalog no. 33R-2544, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTRF1L

Antigène: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Autre désignation: MTRF1L (MTRF1L Produits)

Synonymes: anticorps fj59e12, anticorps wu:fj59e12, anticorps si:dkeyp-9b4.2, anticorps HMRF1L, anticorps MRF1L, anticorps mtRF1a, anticorps 9130004K12Rik, anticorps mitochondrial translational release factor 1 like, anticorps mitochondrial translational release factor 1-like, anticorps MTRF1L, anticorps mtrf1l, anticorps Mtrf1l

Sujet: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Poids moléculaire: 30 kDa (MW of target protein)