DBT anticorps (N-Term)

N° du produit ABIN631072

Détail du produit anti-DBT anticorps

Antigène: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DBT est non-conjugé

Application: Western Blotting (WB)

Specificité: DBT antibody was raised against the N terminal of DBT

Purification: Affinity purified

Immunogène: DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DBT Blocking Peptide, catalog no. 33R-6946, is also available for use as a blocking control in assays to test for specificity of this DBT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DBT

Antigène: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Autre désignation: DBT (DBT Produits)

Synonymes: anticorps BCATE2, anticorps BCKAD-E2, anticorps BCKADE2, anticorps E2, anticorps E2B, anticorps D3Wsu60e, anticorps im:7147214, anticorps zgc:103768, anticorps E2b, anticorps dihydrolipoamide branched chain transacylase E2, anticorps hypothetical protein, anticorps dihydrolipoamide branched chain transacylase E2 L homeolog, anticorps DBT, anticorps dbt, anticorps CpipJ_CPIJ006326, anticorps BDBG_05874, anticorps NAEGRDRAFT_78509, anticorps VDBG_04820, anticorps PGTG_17722, anticorps Dbt, anticorps dbt.L

Classe de substances: Viral Protein

Sujet: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 46 kDa (MW of target protein)