DBT anticorps (N-Term)

N° du produit ABIN631072

Cet anticorps Lapin Polyclonal détecte spécifiquement DBT dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DBT anticorps (N-Term) (ABIN631072)

Antigène: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DBT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DBT anticorps

Épitope: N-Term

Specificité: DBT antibody was raised against the N terminal of DBT

Purification: Affinity purified

Immunogène: DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DBT Blocking Peptide, (ABIN5613129), is also available for use as a blocking control in assays to test for specificity of this DBT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DBT

Antigène: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Autre désignation: DBT

Sujet: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Poids moléculaire: 46 kDa (MW of target protein)