ACADL anticorps (Middle Region)

N° du produit ABIN631083

Détail du produit anti-ACADL anticorps

Antigène: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADL est non-conjugé

Application: Western Blotting (WB)

Specificité: ACADL antibody was raised against the middle region of ACADL

Purification: Affinity purified

Immunogène: ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADL Blocking Peptide, catalog no. 33R-5283, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACADL

Antigène: ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))

Autre désignation: ACADL (ACADL Produits)

Synonymes: anticorps zgc:55656, anticorps ACAD4, anticorps LCAD, anticorps ACOADA, anticorps AA960361, anticorps AU018452, anticorps C79855, anticorps acyl-CoA dehydrogenase long chain, anticorps acyl-CoA dehydrogenase, long chain, anticorps acyl-CoA dehydrogenase, long chain L homeolog, anticorps acyl-Coenzyme A dehydrogenase, long-chain, anticorps acadl, anticorps ACADL, anticorps Acadl, anticorps acadl.L

Sujet: ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process