Aminomethyltransferase anticorps (N-Term)

N° du produit ABIN631086

Cet anticorps anti-Aminomethyltransferase est un anticorps Lapin Polyclonal détectant Aminomethyltransferase dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour Aminomethyltransferase anticorps (N-Term) (ABIN631086)

Antigène: Aminomethyltransferase (AMT)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aminomethyltransferase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Aminomethyltransferase anticorps

Épitope: N-Term

Specificité: AMT antibody was raised against the N terminal of AMT

Purification: Affinity purified

Immunogène: AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMT Blocking Peptide, (ABIN5612052), is also available for use as a blocking control in assays to test for specificity of this AMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aminomethyltransferase

Antigène: Aminomethyltransferase (AMT)

Autre désignation: AMT

Sujet: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Poids moléculaire: 44 kDa (MW of target protein)