WDR8 anticorps (Middle Region)

N° du produit ABIN631094

Détail du produit anti-WDR8 anticorps

Antigène: WDR8 (WD Repeat Domain 8 (WDR8))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR8 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR8 antibody was raised against the middle region of WDR8

Purification: Affinity purified

Immunogène: WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR8 Blocking Peptide, catalog no. 33R-3188, is also available for use as a blocking control in assays to test for specificity of this WDR8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR8

Antigène: WDR8 (WD Repeat Domain 8 (WDR8))

Autre désignation: WDR8 (WDR8 Produits)

Synonymes: anticorps fi45a07, anticorps zgc:56287, anticorps wu:fi45a07, anticorps Wdr8, anticorps MGC75994, anticorps WDR8, anticorps MGC85022, anticorps 2610044M17Rik, anticorps 5330425N03Rik, anticorps Dd57, anticorps WD repeat containing, antisense to TP73, anticorps WD repeat containing, antisense to TP73 L homeolog, anticorps WD repeat containing, antisense to Trp73, anticorps wrap73, anticorps Wrap73, anticorps WRAP73, anticorps wrap73.L

Sujet: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD).

Poids moléculaire: 51 kDa (MW of target protein)