GLYATL2 anticorps (Middle Region)

N° du produit ABIN631098

Cet anticorps anti-GLYATL2 Polyclonal Lapin (ABIN631098) détecte spécifiquement GLYATL2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour GLYATL2 anticorps (Middle Region) (ABIN631098)

Antigène: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLYATL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLYATL2 anticorps

Épitope: Middle Region

Specificité: GLYATL2 antibody was raised against the middle region of GLYATL2

Purification: Affinity purified

Immunogène: GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLYATL2 Blocking Peptide, (ABIN940229), is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYATL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLYATL2

Antigène: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Autre désignation: GLYATL2

Sujet: GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

Poids moléculaire: 34 kDa (MW of target protein)