LACTB anticorps (Middle Region)
-
- Antigène Voir toutes LACTB Anticorps
- LACTB (Lactamase, beta (LACTB))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LACTB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Beta Lactamase antibody was raised against the middle region of LACTB
- Purification
- Affinity purified
- Immunogène
- Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
- Top Product
- Discover our top product LACTB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Beta Lactamase Blocking Peptide, catalog no. 33R-7526, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LACTB (Lactamase, beta (LACTB))
- Autre désignation
- beta Lactamase (LACTB Produits)
- Synonymes
- anticorps BA2507, anticorps PSPTO2834, anticorps PSPTO3594, anticorps G24, anticorps MRPL56, anticorps LACT-1, anticorps Lact1, anticorps Mrpl56, anticorps zgc:110419, anticorps beta-lactamase, anticorps class C beta-lactamase AmpC, anticorps metal-dependent hydrolase, anticorps lactamase beta, anticorps Beta-lactamase, anticorps lactamase, beta, anticorps metallo-beta-lactamase domain containing 2, anticorps Beta lactamase, anticorps bla1, anticorps ampC, anticorps PSPTO_2834, anticorps GSU1378, anticorps MCA2220, anticorps CJE0344, anticorps LACTB, anticorps Rmar_1357, anticorps MGYG_07395, anticorps ML5_3452, anticorps bla, anticorps Lactb, anticorps lactb, anticorps MBLAC2, anticorps blaKPC-2
- Sujet
- LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
- Poids moléculaire
- 41 kDa (MW of target protein)
-