HIBADH anticorps (Middle Region)
-
- Antigène Voir toutes HIBADH Anticorps
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HIBADH est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HIBADH antibody was raised against the middle region of HIBADH
- Purification
- Affinity purified
- Immunogène
- HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
- Top Product
- Discover our top product HIBADH Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HIBADH Blocking Peptide, catalog no. 33R-10017, is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
- Autre désignation
- HIBADH (HIBADH Produits)
- Synonymes
- anticorps NS5ATP1, anticorps 6430402H10Rik, anticorps AI265272, anticorps hibadh, anticorps zgc:66262, anticorps wu:fb07f02, anticorps zgc:100804, anticorps 3-hydroxyisobutyrate dehydrogenase, anticorps 3-hydroxyisobutyrate dehydrogenase b, anticorps 3-hydroxyisobutyrate dehydrogenase S homeolog, anticorps 3-hydroxyisobutyrate dehydrogenase a, anticorps HIBADH, anticorps Hibadh, anticorps hibadhb, anticorps hibadh.S, anticorps hibadha
- Sujet
- 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.
- Poids moléculaire
- 35 kDa (MW of target protein)
-