HIBADH anticorps (Middle Region)

N° du produit ABIN631102

Cet anticorps Lapin Polyclonal détecte spécifiquement HIBADH dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HIBADH anticorps (Middle Region) (ABIN631102)

Antigène: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HIBADH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HIBADH anticorps

Épitope: Middle Region

Specificité: HIBADH antibody was raised against the middle region of HIBADH

Purification: Affinity purified

Immunogène: HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIBADH Blocking Peptide, (ABIN935970), is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HIBADH

Antigène: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Autre désignation: HIBADH

Sujet: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.

Poids moléculaire: 35 kDa (MW of target protein)