ACADSB anticorps (Middle Region)

N° du produit ABIN631104

Cet anticorps anti-ACADSB est un anticorps Lapin Polyclonal détectant ACADSB dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour ACADSB anticorps (Middle Region) (ABIN631104)

Antigène: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACADSB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACADSB anticorps

Épitope: Middle Region

Specificité: ACADSB antibody was raised against the middle region of ACADSB

Purification: Affinity purified

Immunogène: ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACADSB Blocking Peptide, (ABIN938802), is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACADSB

Antigène: ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))

Autre désignation: ACADSB

Sujet: Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process