MTCH2 anticorps

N° du produit ABIN631106

Détail du produit anti-MTCH2 anticorps

Antigène: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTCH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTCH2 Blocking Peptide, catalog no. 33R-1082, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTCH2

Antigène: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Autre désignation: MTCH2 (MTCH2 Produits)

Synonymes: anticorps MIMP, anticorps SLC25A50, anticorps Hspc032, anticorps fi20c06, anticorps fj35g12, anticorps wu:fi20c06, anticorps wu:fj35g12, anticorps 2310034D24Rik, anticorps 4930539J07Rik, anticorps HSPC032, anticorps mitochondrial carrier 2, anticorps mitochondrial carrier 2 L homeolog, anticorps mitochondrial carrier homolog 2, anticorps MTCH2, anticorps mtch2.L, anticorps Mtch2, anticorps mtch2

Sujet: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Poids moléculaire: 33 kDa (MW of target protein)