RPS21 anticorps (N-Term)

N° du produit ABIN631108

Cet anticorps Lapin Polyclonal détecte spécifiquement RPS21 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RPS21 anticorps (N-Term) (ABIN631108)

Antigène: RPS21 (Ribosomal Protein S21 (RPS21))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS21 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPS21 anticorps

Épitope: N-Term

Specificité: RPS21 antibody was raised against the N terminal of RPS21

Purification: Affinity purified

Immunogène: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS21 Blocking Peptide, (ABIN5615947), is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS21

Antigène: RPS21 (Ribosomal Protein S21 (RPS21))

Autre désignation: RPS21

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 9 kDa (MW of target protein)