PIWIL1 anticorps

N° du produit ABIN631111

Cet anticorps Lapin Polyclonal détecte spécifiquement PIWIL1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PIWIL1 anticorps (ABIN631111)

Antigène: PIWIL1 (Piwi-Like 1 (PIWIL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIWIL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIWIL1 anticorps

Purification: Affinity purified

Immunogène: PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIWIL1 Blocking Peptide, (ABIN5615387), is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIWIL1

Antigène: PIWIL1 (Piwi-Like 1 (PIWIL1))

Autre désignation: PIWIL1

Sujet: PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.

Poids moléculaire: 98 kDa (MW of target protein)