Adenylate Kinase 1 anticorps (N-Term)

N° du produit ABIN631113

Cet anticorps anti-Adenylate Kinase 1 est un anticorps Lapin Polyclonal détectant Adenylate Kinase 1 dans WB. Adapté pour Humain.

Aperçu rapide pour Adenylate Kinase 1 anticorps (N-Term) (ABIN631113)

Antigène: Adenylate Kinase 1 (AK1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adenylate Kinase 1 anticorps

Épitope: N-Term

Specificité: AK1 antibody was raised against the N terminal of AK1

Purification: Affinity purified

Immunogène: AK1 antibody was raised using the N terminal of AK1 corresponding to a region with amino acids HLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK1 Blocking Peptide, (ABIN939176), is also available for use as a blocking control in assays to test for specificity of this AK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 1

Antigène: Adenylate Kinase 1 (AK1)

Autre désignation: AK1

Sujet: Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process