ACADL anticorps (N-Term)
-
- Antigène Voir toutes ACADL Anticorps
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACADL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACADL antibody was raised against the N terminal of ACADL
- Purification
- Affinity purified
- Immunogène
- ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR
- Top Product
- Discover our top product ACADL Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACADL Blocking Peptide, catalog no. 33R-5609, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACADL (Acyl-CoA Dehydrogenase, Long Chain (ACADL))
- Autre désignation
- ACADL (ACADL Produits)
- Synonymes
- anticorps zgc:55656, anticorps ACAD4, anticorps LCAD, anticorps ACOADA, anticorps AA960361, anticorps AU018452, anticorps C79855, anticorps acyl-CoA dehydrogenase long chain, anticorps acyl-CoA dehydrogenase, long chain, anticorps acyl-CoA dehydrogenase, long chain L homeolog, anticorps acyl-Coenzyme A dehydrogenase, long-chain, anticorps acadl, anticorps ACADL, anticorps Acadl, anticorps acadl.L
- Sujet
- ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-