TUFM anticorps (Middle Region)

N° du produit ABIN631117

Détail du produit anti-TUFM anticorps

Antigène: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUFM est non-conjugé

Application: Western Blotting (WB)

Specificité: TUFM antibody was raised against the middle region of TUFM

Purification: Affinity purified

Immunogène: TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUFM

Antigène: TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))

Autre désignation: TUFM (Tufm Produits)

Synonymes: anticorps TUFM, anticorps D250, anticorps fi06f04, anticorps wu:fi06f04, anticorps zgc:110766, anticorps COXPD4, anticorps EF-TuMT, anticorps EFTU, anticorps P43, anticorps 2300002G02Rik, anticorps C76308, anticorps C76389, anticorps Tu translation elongation factor, mitochondrial, anticorps TUFM, anticorps tufm, anticorps Tufm

Sujet: TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.

Poids moléculaire: 50 kDa (MW of target protein)