BRWD1 anticorps (N-Term)

N° du produit ABIN631121

L’anticorps Lapin Polyclonal anti-BRWD1 a été validé pour WB. Il convient pour détecter BRWD1 dans des échantillons de Humain.

Aperçu rapide pour BRWD1 anticorps (N-Term) (ABIN631121)

Antigène: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRWD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BRWD1 anticorps

Épitope: N-Term

Specificité: BRWD1 antibody was raised against the N terminal of BRWD1

Purification: Affinity purified

Immunogène: BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRWD1 Blocking Peptide, (ABIN5612368), is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRWD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRWD1

Antigène: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Autre désignation: BRWD1

Sujet: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Poids moléculaire: 13 kDa (MW of target protein)