BRWD1 anticorps (N-Term)

N° du produit ABIN631121

Détail du produit anti-BRWD1 anticorps

Antigène: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRWD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BRWD1 antibody was raised against the N terminal of BRWD1

Purification: Affinity purified

Immunogène: BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRWD1 Blocking Peptide, catalog no. 33R-5643, is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRWD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRWD1

Antigène: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Autre désignation: BRWD1 (BRWD1 Produits)

Synonymes: anticorps WDR9, anticorps BRWD1, anticorps C21orf107, anticorps N143, anticorps 5330419I02Rik, anticorps D530019K20Rik, anticorps G1-403-16, anticorps Wdr9, anticorps repro5, anticorps bromodomain and WD repeat domain containing 1, anticorps bromodomain and WD repeat-containing protein 1, anticorps BRWD1, anticorps LOC100226455, anticorps brwd1, anticorps Brwd1

Sujet: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Poids moléculaire: 13 kDa (MW of target protein)