TXNDC5 anticorps (N-Term)

N° du produit ABIN631124

L’anticorps Lapin Polyclonal anti-TXNDC5 a été validé pour WB. Il convient pour détecter TXNDC5 dans des échantillons de Humain.

Aperçu rapide pour TXNDC5 anticorps (N-Term) (ABIN631124)

Antigène: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXNDC5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TXNDC5 anticorps

Épitope: N-Term

Specificité: TXNDC5 antibody was raised against the N terminal of TXNDC5

Purification: Affinity purified

Immunogène: TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC5 Blocking Peptide, (ABIN936846), is also available for use as a blocking control in assays to test for specificity of this TXNDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXNDC5

Antigène: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Autre désignation: TXNDC5

Sujet: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis