TXNDC5 anticorps (N-Term)

N° du produit ABIN631124

Détail du produit anti-TXNDC5 anticorps

Antigène: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXNDC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: TXNDC5 antibody was raised against the N terminal of TXNDC5

Purification: Affinity purified

Immunogène: TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNDC5 Blocking Peptide, catalog no. 33R-1460, is also available for use as a blocking control in assays to test for specificity of this TXNDC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXNDC5

Antigène: TXNDC5 (Thioredoxin Domain Containing 5 (Endoplasmic Reticulum) (TXNDC5))

Autre désignation: TXNDC5 (TXNDC5 Produits)

Synonymes: anticorps ENDOPDI, anticorps ERP46, anticorps HCC-2, anticorps PDIA15, anticorps STRF8, anticorps UNQ364, anticorps wu:fb20a07, anticorps wu:fb55b10, anticorps zgc:66265, anticorps AL022641, anticorps ERp46, anticorps PC-TRP, anticorps PDIL5-1, anticorps Txndc5, anticorps erp46, anticorps TXNDC5, anticorps MUTED, anticorps endopdi, anticorps unq364, anticorps thioredoxin domain containing 5, anticorps protein disulfide isomerase, anticorps thioredoxin domain containing 5 L homeolog, anticorps biogenesis of lysosomal organelles complex 1 subunit 5, anticorps TXNDC5, anticorps txndc5, anticorps Txndc5, anticorps PDIL5-1, anticorps txndc5.L, anticorps BLOC1S5, anticorps CC1G_08236

Sujet: TXNDC5 is a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis