PYGB anticorps (N-Term)

N° du produit ABIN631127

L’anticorps Lapin Polyclonal anti-PYGB a été validé pour WB. Il convient pour détecter PYGB dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PYGB anticorps (N-Term) (ABIN631127)

Antigène: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PYGB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PYGB anticorps

Épitope: N-Term

Specificité: PYGB antibody was raised against the N terminal of PYGB

Purification: Affinity purified

Immunogène: PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PYGB Blocking Peptide, (ABIN5615691), is also available for use as a blocking control in assays to test for specificity of this PYGB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PYGB

Antigène: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Autre désignation: PYGB

Sujet: PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process