IER5 anticorps (N-Term)

N° du produit ABIN631134

Cet anticorps anti-IER5 est un anticorps Lapin Polyclonal détectant IER5 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour IER5 anticorps (N-Term) (ABIN631134)

Antigène: IER5 (Immediate Early Response 5 (IER5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IER5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IER5 anticorps

Épitope: N-Term

Specificité: IER5 antibody was raised against the N terminal of IER5

Purification: Affinity purified

Immunogène: IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IER5 Blocking Peptide, (ABIN5614138), is also available for use as a blocking control in assays to test for specificity of this IER5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IER5

Antigène: IER5 (Immediate Early Response 5 (IER5))

Autre désignation: IER5

Sujet: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.

Poids moléculaire: 34 kDa (MW of target protein)