SNRK anticorps (Middle Region)

N° du produit ABIN631138

Détail du produit anti-SNRK anticorps

Antigène: SNRK (SNF Related Kinase (SNRK))

Épitope: Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRK est non-conjugé

Application: Western Blotting (WB)

Specificité: SNRK antibody was raised against the middle region of SNRK

Purification: Affinity purified

Immunogène: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRK Blocking Peptide, catalog no. 33R-8848, is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRK

Antigène: SNRK (SNF Related Kinase (SNRK))

Autre désignation: SNRK (SNRK Produits)

Synonymes: anticorps HSNFRK, anticorps 2010012F07Rik, anticorps AI448042, anticorps AW547029, anticorps E030034B15, anticorps R74830, anticorps mKIAA0096, anticorps SNF related kinase, anticorps SNRK, anticorps Snrk

Sujet: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Poids moléculaire: 84 kDa (MW of target protein)