PCNP anticorps (Middle Region)

N° du produit ABIN631140

Cet anticorps anti-PCNP est un anticorps Lapin Polyclonal détectant PCNP dans WB. Adapté pour Humain.

Aperçu rapide pour PCNP anticorps (Middle Region) (ABIN631140)

Antigène: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCNP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCNP anticorps

Épitope: Middle Region

Specificité: PCNP antibody was raised against the middle region of PCNP

Purification: Affinity purified

Immunogène: PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCNP Blocking Peptide, (ABIN936688), is also available for use as a blocking control in assays to test for specificity of this PCNP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCNP

Antigène: PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))

Autre désignation: PCNP

Sujet: PCNP may be involved in cell cycle regulation.

Poids moléculaire: 19 kDa (MW of target protein)