PCNP anticorps (Middle Region)
-
- Antigène Voir toutes PCNP Anticorps
- PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCNP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCNP antibody was raised against the middle region of PCNP
- Purification
- Affinity purified
- Immunogène
- PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD
- Top Product
- Discover our top product PCNP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCNP Blocking Peptide, catalog no. 33R-1302, is also available for use as a blocking control in assays to test for specificity of this PCNP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCNP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCNP (PEST Proteolytic Signal Containing Nuclear Protein (PCNP))
- Autre désignation
- PCNP (PCNP Produits)
- Synonymes
- anticorps 1110018D06Rik, anticorps AI647035, anticorps PEST proteolytic signal containing nuclear protein, anticorps PCNP, anticorps Pcnp
- Sujet
- PCNP may be involved in cell cycle regulation.
- Poids moléculaire
- 19 kDa (MW of target protein)
-