GSTA4 anticorps (C-Term)

N° du produit ABIN631150

Détail du produit anti-GSTA4 anticorps

Antigène: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTA4 antibody was raised against the C terminal of GSTA4

Purification: Affinity purified

Immunogène: GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTA4 Blocking Peptide, catalog no. 33R-5405, is also available for use as a blocking control in assays to test for specificity of this GSTA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTA4

Antigène: GSTA4 (Glutathione S-Transferase alpha 4 (GSTA4))

Autre désignation: GSTA4 (GSTA4 Produits)

Synonymes: anticorps GSTA4-4, anticorps GTA4, anticorps gsta4-4, anticorps gta4, anticorps tGSTA4, anticorps GST5.7, anticorps mGsta4, anticorps glutathione S-transferase alpha 4, anticorps glutathione S-transferase alpha 4-like, anticorps glutathione S-transferase alpha 4 S homeolog, anticorps glutathione S-transferase 3, anticorps glutathione S-transferase, alpha 4, anticorps glutathione S-transferase A4, anticorps GSTA4, anticorps Gsta4, anticorps GSTA4L, anticorps gsta4, anticorps gsta4.S, anticorps LOC100341622

Sujet: GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.

Poids moléculaire: 26 kDa (MW of target protein)