Epsin 2 anticorps (Middle Region)
-
- Antigène Voir toutes Epsin 2 (EPN2) Anticorps
- Epsin 2 (EPN2)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Epsin 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Epsin 2 antibody was raised against the middle region of EPN2
- Purification
- Affinity purified
- Immunogène
- Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
- Top Product
- Discover our top product EPN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Epsin 2 Blocking Peptide, catalog no. 33R-2101, is also available for use as a blocking control in assays to test for specificity of this Epsin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Epsin 2 (EPN2)
- Autre désignation
- Epsin 2 (EPN2 Produits)
- Synonymes
- anticorps CG13853, anticorps CG13854, anticorps CG31170, anticorps CG31285, anticorps CG42250, anticorps Dmel\\CG42250, anticorps Dmel_CG31170, anticorps Dmel_CG31285, anticorps Epsin, anticorps LqfR, anticorps XII-10, anticorps epsin, anticorps epsin-like, anticorps epsin02, anticorps epsinR, anticorps l(3)03685, anticorps l(3)A9, anticorps l(3)SG62, anticorps l(3)XII-10, anticorps l(3)dsl-9, anticorps l(3)dsl9, anticorps EHB21, anticorps 9530051D10Rik, anticorps AA536924, anticorps Ibp2, anticorps epsin-2, anticorps liquid facets-Related, anticorps epsin 2, anticorps epsin-2, anticorps Epsin 2, anticorps epsin 2 S homeolog, anticorps lqfR, anticorps EPN2, anticorps EDI_326810, anticorps EDI_044850, anticorps Bm1_38210, anticorps EHI_104950, anticorps epn2, anticorps Epn2, anticorps epn2.S
- Sujet
- EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- EGFR Downregulation
-