APEH anticorps (N-Term)

N° du produit ABIN631156

Cet anticorps Lapin Polyclonal détecte spécifiquement APEH dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour APEH anticorps (N-Term) (ABIN631156)

Antigène: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APEH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-APEH anticorps

Épitope: N-Term

Specificité: APEH antibody was raised against the N terminal of APEH

Purification: Affinity purified

Immunogène: APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APEH Blocking Peptide, (ABIN5612106), is also available for use as a blocking control in assays to test for specificity of this APEH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APEH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APEH

Antigène: APEH (N-Acylaminoacyl-Peptide Hydrolase (APEH))

Autre désignation: APEH

Sujet: APEH is the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.

Poids moléculaire: 81 kDa (MW of target protein)