ACSBG2 anticorps (Middle Region)

N° du produit ABIN631171

Détail du produit anti-ACSBG2 anticorps

Antigène: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACSBG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACSBG2 antibody was raised against the middle region of ACSBG2

Purification: Affinity purified

Immunogène: ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSBG2 Blocking Peptide, catalog no. 33R-5237, is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACSBG2

Antigène: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Autre désignation: ACSBG2 (ACSBG2 Produits)

Synonymes: anticorps ACSBG2, anticorps fk81d02, anticorps im:7046047, anticorps sb:cb76, anticorps si:dkey-240a9.3, anticorps wu:fj55d04, anticorps wu:fk81d02, anticorps BGR, anticorps BRGL, anticorps PRTD-NY3, anticorps PRTDNY3, anticorps Bgr, anticorps acyl-CoA synthetase bubblegum family member 2, anticorps long-chain-fatty-acid--CoA ligase ACSBG2, anticorps acyl-CoA synthetase bubblegum family member 2 L homeolog, anticorps ACSBG2, anticorps LOC476732, anticorps acsbg2, anticorps acsbg2.L, anticorps Acsbg2

Sujet: ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process