IMPA2 anticorps (Middle Region)

N° du produit ABIN631172

Détail du produit anti-IMPA2 anticorps

Antigène: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: IMPA2 antibody was raised against the middle region of IMPA2

Purification: Affinity purified

Immunogène: IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPA2 Blocking Peptide, catalog no. 33R-7934, is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPA2

Antigène: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Autre désignation: IMPA2 (IMPA2 Produits)

Synonymes: anticorps zgc:110201, anticorps 2210415D20Rik, anticorps AI326924, anticorps AW259601, anticorps inositol monophosphatase 2, anticorps inositol(myo)-1(or 4)-monophosphatase 2, anticorps inositol (myo)-1(or 4)-monophosphatase 2, anticorps IMPA2, anticorps impa2, anticorps MGYG_08537, anticorps Impa2

Sujet: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Poids moléculaire: 32 kDa (MW of target protein)