IMPA2 anticorps (Middle Region)

N° du produit ABIN631172

L’anticorps anti-IMPA2 Polyclonal Lapin est utilisé pour la détection de IMPA2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour IMPA2 anticorps (Middle Region) (ABIN631172)

Antigène: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IMPA2 anticorps

Épitope: Middle Region

Specificité: IMPA2 antibody was raised against the middle region of IMPA2

Purification: Affinity purified

Immunogène: IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPA2 Blocking Peptide, (ABIN5614186), is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPA2

Antigène: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Autre désignation: IMPA2

Sujet: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Poids moléculaire: 32 kDa (MW of target protein)