PARD6A anticorps

N° du produit ABIN631173

Cet anticorps anti-PARD6A Polyclonal Lapin (ABIN631173) détecte spécifiquement PARD6A dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PARD6A anticorps (ABIN631173)

Antigène: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARD6A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PARD6A anticorps

Purification: Affinity purified

Immunogène: PARD6 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARD6A Blocking Peptide, (ABIN5615217), is also available for use as a blocking control in assays to test for specificity of this PARD6A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARD6A

Antigène: PARD6A (Par-6 Partitioning Defective 6 Homolog alpha (PARD6A))

Autre désignation: PARD6A

Sujet: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization