AGXT2L1 anticorps (Middle Region)

N° du produit ABIN631174

Cet anticorps Lapin Polyclonal détecte spécifiquement AGXT2L1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour AGXT2L1 anticorps (Middle Region) (ABIN631174)

Antigène: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGXT2L1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AGXT2L1 anticorps

Épitope: Middle Region

Specificité: AGXT2 L1 antibody was raised against the middle region of AGXT2 1

Purification: Affinity purified

Immunogène: AGXT2 L1 antibody was raised using the middle region of AGXT2 1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGXT2L1 Blocking Peptide, (ABIN940025), is also available for use as a blocking control in assays to test for specificity of this AGXT2L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGXT2L1

Antigène: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Autre désignation: AGXT2L1

Sujet: AGXT2L1 belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

Poids moléculaire: 56 kDa (MW of target protein)