ALDOC anticorps (C-Term)

N° du produit ABIN631176

Cet anticorps anti-ALDOC est un anticorps Lapin Polyclonal détectant ALDOC dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ALDOC anticorps (C-Term) (ABIN631176)

Antigène: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDOC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALDOC anticorps

Épitope: C-Term

Specificité: ALDOC antibody was raised against the C terminal of ALDOC

Purification: Affinity purified

Immunogène: ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDOC Blocking Peptide, (ABIN937153), is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDOC

Antigène: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Autre désignation: ALDOC

Sujet: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Poids moléculaire: 39 kDa (MW of target protein)